Protein coding transcript 204928

• Transcript: Ll_transcript_266970
• CDS coordinates: 300-647 (+)
• Peptide sequence: MMEANSNVEESENNTKKIPANHLLYAKLSTGELVLRLGAECPSGDMTLLETGEPVYSPVTQEGPLLTEDLIKETEEFVLRTGSVGAGCSHLLSDMQAFKAANPGCILEDFVRWHSP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_266970

• Blastp: Rab3 GTPase-activating protein catalytic subunit from Rattus with 53.09% of identity
• Blastx: Rab3 GTPase-activating protein catalytic subunit from Mus with 53.09% of identity
• Eggnog: RAB3 GTPase activating protein subunit 1 (Catalytic)(ENOG410Y2R4)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002243)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440686.1)
• Pfam: Rab3 GTPase-activating protein catalytic subunit (PF13890.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;