Protein coding transcript 204929

• Transcript: Ll_transcript_266976
• CDS coordinates: 278-622 (+)
• Peptide sequence: MLMAGNLWRELWETSKPVPAVKQAPLFDEDLAVEGILNAFEDIRPSELFEQLFISLLGVGLAIAEPMLSGESDFSKLFNDCKDYVVTTCQSNKFSEKVDELVQVGVLEENGADL*
• ORF Type: complete

Annotations of Ll_transcript_266976

• Blastp: Rab3 GTPase-activating protein catalytic subunit from Danio with 37.7% of identity
• Blastx: -
• Eggnog: RAB3 GTPase activating protein subunit 1 (Catalytic)(ENOG410Y2R4)
• Kegg: Link to kegg annotations (777744)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440686.1)
• Pfam: Rab3 GTPase-activating protein catalytic subunit (PF13890.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;