Protein coding transcript 204965

• Transcript: Ll_transcript_267396
• CDS coordinates: 3-323 (+)
• Peptide sequence: SMYTLFMEHTHTLVFEKMLNLPSRCNIGRCTHIFMILNFDDWLDQELLALGERIGHVSTGLSEDMLSKCLTESIYCSSDQTQDEATCVVCLVSFFSSSSSYSIYTK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_267396

• Blastp: E3 ubiquitin-protein ligase MBR2 from Arabidopsis with 40% of identity
• Blastx: E3 ubiquitin-protein ligase MBR2 from Arabidopsis with 40% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G34040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425433.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;