Transcript | Ll_transcript_268602 |
---|---|
CDS coordinates | 483-1355 (+) |
Peptide sequence | MIHVVFGVLHLIVSLGLILAMDKFLKQAFVAASIKFPSALFGMFCIFSVLIILDSTVPSAAKALVNFFEPAFLFIQRWLPLFYVPSLVVLPLYVKDIPAASGIKISLIIVGGWLATLCVAGFTAIAVRKAVNTQLVDAEPMGKPSPFSTIEVWTWTAVLITSFVVALFYPTALGTSARTCLPFLLAATVLGYIVGSGLPSNVKKVFHPIICCALSADITAYAFAYLSKSGLEPVLGYYLTKVSSNPGAGDILMGFLGSVILSFAFSMFKQRKLVKRHAAEIFTSVIISTVF |
ORF Type | 3prime_partial |
Blastp | Plastidal glycolate/glycerate translocator 1, chloroplastic from Arabidopsis with 79.09% of identity |
---|---|
Blastx | Plastidal glycolate/glycerate translocator 1, chloroplastic from Arabidopsis with 75.91% of identity |
Eggnog | cytolysis(COG1346) |
Kegg | Link to kegg annotations (AT1G32080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424215.1) |
Pfam | LrgB-like family (PF04172.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer