Protein coding transcript 205076

• Transcript: Ll_transcript_268586
• CDS coordinates: 1136-1756 (+)
• Peptide sequence: MADLIEKELQSFSEPEEAMIFFSAHGVPVSYVEDAGDPYRDQMEDCIFLIMQELKARGINNEHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAVPVSFVSEHIETLEEIDMEYKELALESGIKNWARVPALGLTPSFITDLADAVIEALPSATALYAPTSTSEDVDHDPITYFIKIFFGSVLAFILFFSPKMIMAFKNHVI*
• ORF Type: complete

Annotations of Ll_transcript_268586

• Blastp: Ferrochelatase-2, chloroplastic from Cucumis with 78.16% of identity
• Blastx: Ferrochelatase-2, chloroplastic from Cucumis with 79.85% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101216568)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416925.1)
• Pfam: Ferrochelatase (PF00762.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;