Protein coding transcript 205167

• Transcript: Ll_transcript_269337
• CDS coordinates: 192-992 (+)
• Peptide sequence: MDWNAKSPSQWDWEHPLLLNAKTTEISKSLPPNRNGETNQEINVGLLDSSVGSGCSGSELIHASSRSSISASINSSSNRDSKTSMYTFETSLDGSTGKRELSKVQISHRLEPSSASGESLLSLKLGKRLYFEDVYSGSISKSPSFSGAPMSSLSTGKKCKSNGQNVQFPRCQVEGCGLDLSSAKDYHSKHRVCDSHSKSPKVLIAGMVCRFCQQCSRFHGLSEFDEKKRSCRRRLSDHNARRRKPHPVATRLNQPSSPYGINLKAS*
• ORF Type: complete

Annotations of Ll_transcript_269337

• Blastp: Squamosa promoter-binding-like protein 2 from Arabidopsis with 47.58% of identity
• Blastx: Squamosa promoter-binding-like protein 2 from Arabidopsis with 48.85% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG410YKP9)
• Kegg: Link to kegg annotations (AT5G43270)
• CantataDB: Link to cantataDB annotations (CNT0002899)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464820.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;