Protein coding transcript 205175

• Transcript: Ll_transcript_269351
• CDS coordinates: 2-514 (+)
• Peptide sequence: QNLQHPSCQVEGCGLDLSSAKDYHRKHRVCENHSKFPKVIIAGSERRFCQQCSRFHDLSEFDDKKRSCRRRLSDHNARRRKPHSETVRFKTSALSSSPYDRRQLMIPFAYSRTATNLACQDTHSSKLPQTKDFLFNPAKANNEIPSIGTMVSYDFNPPFTLKGIATKSANR
• ORF Type: internal

Annotations of Ll_transcript_269351

• Blastp: Squamosa promoter-binding-like protein 12 from Oryza sativa with 47.12% of identity
• Blastx: Squamosa promoter-binding-like protein 12 from Oryza sativa with 47.12% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG410YKP9)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002899)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414704.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;