Protein coding transcript 205176

• Transcript: Ll_transcript_269338
• CDS coordinates: 1-756 (+)
• Peptide sequence: CESHSKSPKVVIAGMERRFCQQCSRFHGLSEFDEKKRSCRRRLTDHNARRRKPHPVAVRLNQPALSPSLYDGRQHMSPFTYSRAATNLAWQDTHSSKLPQAKDFLLNPAKASNEMPSIGTMVSYDFNSPFISKGIIATRSVNPGIEDSITSSDPNVTQDFHRALSLLSTNSWGSHEPKSISVEHPNKATATAHAMSQRIPIASPEYWHIGQQPVNSGTWISYSNCDDSNRFQEFQLFREPYESGFPYNQLD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_269338

• Blastp: Squamosa promoter-binding-like protein 12 from Oryza sativa with 41.83% of identity
• Blastx: Squamosa promoter-binding-like protein 12 from Oryza sativa with 41.83% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG410YKP9)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002899)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424546.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;