Transcript | Ll_transcript_269352 |
---|---|
CDS coordinates | 1-495 (+) |
Peptide sequence | CESHSKSPKVVIAGMERRFCQQCSRFHGLSEFDEKKRSCRRRLTDHNARRRKPHPVAVRLNQPALSPSLYDGRQHMSPFTYSRAATNLAWQDTHSSKLPQAKDFLLNPAKASNEMPSIGTMVSYDFNSPFISKGIIATRSVNPGCLTSFFIIEPHVTFHLDCYV* |
ORF Type | 5prime_partial |
Blastp | Squamosa promoter-binding-like protein 12 from Oryza sativa with 41.67% of identity |
---|---|
Blastx | Squamosa promoter-binding-like protein 12 from Oryza sativa with 35.12% of identity |
Eggnog | Squamosa promoter-binding-like protein(ENOG410YKP9) |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002899) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424546.1) |
Pfam | SBP domain (PF03110.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer