Protein coding transcript 20531

• Transcript: Ll_transcript_282454
• CDS coordinates: 252-584 (+)
• Peptide sequence: MATPLMAGLAVAAAAYAGRYGIQAWQAFKARPPTMRKFYEGGFQPTMTRREAALILGVRERTPTDKIKEAHRRVMIANHPDAGGSHYLASKINEAKDMLVGKTKGSGSAF*
• ORF Type: complete

Annotations of Ll_transcript_282454

• Blastp: Mitochondrial import inner membrane translocase subunit TIM14-1 from Arabidopsis with 78.57% of identity
• Blastx: Mitochondrial import inner membrane translocase subunit TIM14-3 from Arabidopsis with 80.36% of identity
• Eggnog: DNAj domain protein(COG2214)
• Kegg: Link to kegg annotations (AT2G35795)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459165.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;