Protein coding transcript 205328

• Transcript: Ll_transcript_268402
• CDS coordinates: 193-1476 (+)
• Peptide sequence: MDAKDILGLSKNSFPALEKKSRPHKESHRKPDGISREVYALTGGLPSLMPSIDASHLKKKPPSNEKITWQWLPFSSSARKDNLQLYHWVRIINGVPPTGDYSFAKYNKSVEIIKYTEEEYEKYLTDPMWTKEETDQLFDLCERFDLRFVVIADRFPSSRTVEELKDRYYSVCRAILIARAPSPGDVAAHPVVKEPYNVSQDIERKRALSMVLSQTRQQERRDEEVLVEAKRIAELRMPAKAVQESQLADASNPGAEVTERTIPGETVSSPMVVSSTLTDNAAILASLRTLHVYLRTYALDQMVQSASSSAGLRTIKRVEQTLHDLGVNLKPRVPTKAVCAEHLELRKEILTLLNLQKQVQYKEAEGSSFRDGSYGESPGTPKDQPFIPEFMSFGGERVGKKDHKRKGHGAPSPSAHKRPRKMKASDL*
• ORF Type: complete

Annotations of Ll_transcript_268402

• Blastp: SWR1-complex protein 4 from Arabidopsis with 67.8% of identity
• Blastx: SWR1-complex protein 4 from Arabidopsis with 67.8% of identity
• Eggnog: DNA methyltransferase 1 associated protein 1(ENOG410XSA4)
• Kegg: Link to kegg annotations (AT2G47210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418319.1)
• Pfam: SANT/Myb-like domain of DAMP1 (PF16282.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;