Transcript | Ll_transcript_268996 |
---|---|
CDS coordinates | 240-1448 (+) |
Peptide sequence | MADTTVTSDQSSTSSLNAARIICHVCHTQFSQYTCPRCNSRYCSLQCYKSHSLRCTESFMQENVVQELQQMQPDEQMKHKMLDILKRFHSEEEMDSMDEDSSADSTLSEETLEKILSGEEISFDDLSLEEKKRFQRAIAYGDLSKMIKPWDPWWSKPSARKIRLSREGTQLVQPLSEQELPDDIGSNESTDIPFGPETPLPPLSTLSSKEPSPLLTVHLVDILYSYCFTLRLYNGDWRSDALGSVMVVLNVSLVLGQGGQPETVLEALSHCLEQICSPAYRHMGGLQFGLAVVHDVISLLELGSSALLCAFCDMHRLIREGEKEAKSEKRRKDEIRSTIKLAERKTYFIMCWVHEQPEEVWSSLAAIVSAEKTIMESQRSNKAEILNNKGATKGKCIIEEIQ* |
ORF Type | complete |
Blastp | Zinc finger HIT domain-containing protein 2 from Homo with 28.34% of identity |
---|---|
Blastx | Zinc finger HIT domain-containing protein 2 from Homo with 26.37% of identity |
Eggnog | zinc finger(ENOG4111VC9) |
Kegg | Link to kegg annotations (741) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434973.1) |
Pfam | HIT zinc finger (PF04438.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer