Protein coding transcript 20546

• Transcript: Ll_transcript_281680
• CDS coordinates: 2776-3144 (+)
• Peptide sequence: MSLLKNAIDEERYHDASRLCRHTSGGLVSKNVCEMVKHAINEAQKRSRLSEYTSFSRITSSRGDLDPFDGLYVDAFGLYGADVVQLKWKFGHWNDMDSEKNPSDVEFIEYVEAVKLTGDFSC*
• ORF Type: complete

Annotations of Ll_transcript_281680

• Blastp: Protein EXECUTER 2, chloroplastic from Arabidopsis with 64.13% of identity
• Blastx: Protein EXECUTER 2, chloroplastic from Arabidopsis with 64.13% of identity
• Eggnog: protein EXECUTER 1, chloroplastic-like(ENOG410ZHAF)
• Kegg: Link to kegg annotations (AT1G27510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464075.1)
• Pfam: Domain of unknown function (DUF3506) (PF12014.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;