Protein coding transcript 205556

• Transcript: Ll_transcript_266745
• CDS coordinates: 608-1081 (+)
• Peptide sequence: MQVMLFGASDSFSGDQIMQVTLAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHWEMYAIGGSQRPTIISEGNRFIAPNNINAKEITKRDYAPEEVWKNWQWRSIKDEYINGAFFRQAGPVLTNRPFTRKDMMSSRPGSYVGRLTRYAGILRCRVGKPC*
• ORF Type: complete

Annotations of Ll_transcript_266745

• Blastp: Probable pectate lyase P59 from Lycopersicon with 62.42% of identity
• Blastx: Probable pectate lyase P59 from Lycopersicon with 62.42% of identity
• Eggnog: pectate lyase activity(COG3866)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454789.1)
• Pfam: Pectate lyase (PF00544.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;