Transcript | Ll_transcript_266748 |
---|---|
CDS coordinates | 3-590 (+) |
Peptide sequence | SSKVWIDHVSMRKCQDGLIDVVMGSTAVTISNSHFTDHNEVMLFGASDSFSGDQIMQVTLAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHWEMYAIGGSQHPTIISEGNRFIAPNNINAKEITKRDYATEEVWKNWQWRSINDECMNGAFFRQAGPVLSNRPFSKKDMISARPGSYVGRLTRYAGSIRCRVGKPC* |
ORF Type | 5prime_partial |
Blastp | Probable pectate lyase P59 from Lycopersicon with 66.33% of identity |
---|---|
Blastx | Probable pectate lyase P59 from Lycopersicon with 66.33% of identity |
Eggnog | pectate lyase activity(COG3866) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432025.1) |
Pfam | Pectate lyase (PF00544.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer