| Transcript | Ll_transcript_266749 |
|---|---|
| CDS coordinates | 3-422 (+) |
| Peptide sequence | SSKVWIDHVSMRKCQDGLIDVVMGSTAVTISNSHFTDHNEVMLFGASDSFSGDQIMQVTLAFNHFGKRLIQRMPRCRWGFIHVVNNDYTHWEMYAIGGSQHPTIISEGNRFIAPNNINAKEVYIYIIYIHLHDPISRVS* |
| ORF Type | 5prime_partial |
| Blastp | Probable pectate lyase P59 from Lycopersicon with 79.51% of identity |
|---|---|
| Blastx | Probable pectate lyase P59 from Lycopersicon with 56.47% of identity |
| Eggnog | pectate lyase activity(COG3866) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432025.1) |
| Pfam | Pectate lyase (PF00544.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer