Protein coding transcript 205583

• Transcript: Ll_transcript_267601
• CDS coordinates: 2-892 (+)
• Peptide sequence: KIVALKRVRFHNHDPESVKFMAREINILRRLDHPNIIKLDGLITSSMSHSLYLVFEYMEHDLTGLASNPAIKFSEPQLKCYMQQLLSGLDHCHSHGVLHRDIKGSNLLIDNNGVLKIADFGLASHFDPNHNVPLTSRVVTLWYRPPELLLGANHYGVAVDLWSAGCILGELYTGRPILPGKTEVEQLHRIFKLCGSPSEDYWLKLRLPHLTIFKPANNYRRCVEEAFREYPSPAVRLIATLLSVDPALRGTAAAALNSEFFTSEPLACDPSSLPKYPPSKEIDTRLQDEANRRYLI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_267601

• Blastp: Probable serine/threonine-protein kinase At1g54610 from Arabidopsis with 69.97% of identity
• Blastx: Probable serine/threonine-protein kinase At1g54610 from Arabidopsis with 69.97% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPIR)
• Kegg: Link to kegg annotations (AT1G54610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413242.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;