Transcript | Ll_transcript_267580 |
---|---|
CDS coordinates | 1375-2019 (+) |
Peptide sequence | MSIQQEQRYSNSKNHSGLLKPHREPMSGFLVFPPHEKSDGKEMRNSLSGRVYKKPSHSGPLVPGYSWAKSGREVDGEAPVSNRVNLSELSGLVASRTMSTQDQEENPVHLHYRKPIEVRKSLESTSRSESRRQNQKQIADLTQIDSGRVPSEKLTRDGHGPRRDKIYVSGPLLFQSDNMDVMLKEHDRKIREFSRKARVDKSRARDDKISAKRK* |
ORF Type | complete |
Blastp | Probable serine/threonine-protein kinase At1g09600 from Arabidopsis with 46.94% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase At1g54610 from Arabidopsis with 73.91% of identity |
Eggnog | Cyclin-Dependent Kinase(ENOG410XPIR) |
Kegg | Link to kegg annotations (AT1G09600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453877.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer