Protein coding transcript 205590

• Transcript: Ll_transcript_267583
• CDS coordinates: 140-1507 (+)
• Peptide sequence: MSHSLYLVFEYMEHDLTGLASNPAIKFSEPQLKCYMHQLLSGLNHCHSHGVLHRDIKGSNLLVDNNGVLKIADFGLASYFDPHHSVPLTSRVVTLWYRPPELLLGANHYGVAVDLWSTGCILAELYTGRPILPGKTEVEQLHRIFKLCGSPSEDYWHKLRLPHSSIFKPANHYGRCVAETFKEYPSPAVVLIETLLSVDPAHRGTAAAALKSEFFTSEPLACDPSSLPKYPPSKEIDAKLHDEATRRQGTVGSREQKVGSVVRQDKGTRAHVTGADRGMSIQRDQHFSSSNNLSELPKHHREPVSGFLVFPPHKQSEDAKDTGNNLSGRRYKKPSHSGPLVPGYNNWTRSGKEVDEGAYVSNTVSLSKLSGLVASRTTSSHDQEEQPVQLHHRKPIEIRKSVESTSGSESRRQDQKQIADLTQIESGRVPNEKLTSDGHGPRGNKIYMSGPLLVQS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_267583

• Blastp: Probable serine/threonine-protein kinase At1g54610 from Arabidopsis with 70.56% of identity
• Blastx: Probable serine/threonine-protein kinase At1g54610 from Arabidopsis with 71.43% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPIR)
• Kegg: Link to kegg annotations (AT1G54610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449028.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;