Protein coding transcript 2056

• Transcript: Ll_transcript_325217
• CDS coordinates: 1-366 (+)
• Peptide sequence: PKVVSEINFGPSPIELVKFSKHAWKEGFIKGTIPQLPLSILISVVAVRKLSSDLFPERKFSVTSLSVSVGLMNLLGSWFGAMPCCHGAGGLAGQYKFGGRSGGCVAVLGAAKLILGLVLGTS
• ORF Type: internal

Annotations of Ll_transcript_325217

• Blastp: Molybdate transporter 1 from Arabidopsis with 70.49% of identity
• Blastx: Molybdate transporter 1 from Arabidopsis with 70.49% of identity
• Eggnog: molybdate ion transmembrane transporter activity(ENOG410XTGP)
• Kegg: Link to kegg annotations (AT2G25680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447522.1)
• Pfam: Molybdate transporter of MFS superfamily (PF16983.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;