Transcript | Ll_transcript_318505 |
---|---|
CDS coordinates | 3-302 (+) |
Peptide sequence | GFVLTLLAALLYGFILPLVEFSYSKGKQAITYTLVLEIQLVMCFFASLFCLIGMIINKDFQVDLFLYSASKFNQALFNHSRNKGFLQKMVYFIIPKKLCF |
ORF Type | internal |
Blastp | Purine permease 2 from Arabidopsis with 47.92% of identity |
---|---|
Blastx | Purine permease 2 from Arabidopsis with 47.92% of identity |
Eggnog | purine permease(ENOG410Y9BB) |
Kegg | Link to kegg annotations (AT2G33750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459757.1) |
Pfam | Purine nucleobase transmembrane transport (PF16913.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer