| Transcript | Ll_transcript_318505 |
|---|---|
| CDS coordinates | 3-302 (+) |
| Peptide sequence | GFVLTLLAALLYGFILPLVEFSYSKGKQAITYTLVLEIQLVMCFFASLFCLIGMIINKDFQVDLFLYSASKFNQALFNHSRNKGFLQKMVYFIIPKKLCF |
| ORF Type | internal |
| Blastp | Purine permease 2 from Arabidopsis with 47.92% of identity |
|---|---|
| Blastx | Purine permease 2 from Arabidopsis with 47.92% of identity |
| Eggnog | purine permease(ENOG410Y9BB) |
| Kegg | Link to kegg annotations (AT2G33750) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459757.1) |
| Pfam | Purine nucleobase transmembrane transport (PF16913.4) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer