Protein coding transcript 20572

• Transcript: Ll_transcript_282548
• CDS coordinates: 962-1351 (+)
• Peptide sequence: MHQELMRLPNSHQTDTYNQYAAQDNDDFIQSESDRQMLLIKRQDEELDELTLSVQRIGGVGLTIHEELIGQERIIDELGSEMDSTSNRLNFVQKKVAMVMKKASAKGQIMMILGLFALFIFLFILVFFT*
• ORF Type: complete

Annotations of Ll_transcript_282548

• Blastp: Syntaxin-61 from Arabidopsis with 72.09% of identity
• Blastx: Syntaxin-61 from Arabidopsis with 70.14% of identity
• Eggnog: syntaxin(ENOG410ZZA3)
• Kegg: Link to kegg annotations (AT1G28490)
• CantataDB: Link to cantataDB annotations (CNT0000374)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440725.1)
• Pfam: SNARE domain (PF05739.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;