Protein coding transcript 20575

• Transcript: Ll_transcript_282551
• CDS coordinates: 594-896 (+)
• Peptide sequence: MILVWIYVVSVVDNRRQDEELDELTLSVQRIGGVGLTIHEELLAQVDLRGFMFYASSYFDSKSTRLDNVCLFMCFLQVSLEVVFLCLIQFLRKIYRSKNV*
• ORF Type: complete

Annotations of Ll_transcript_282551

• Blastp: Syntaxin-61 from Arabidopsis with 80.65% of identity
• Blastx: Syntaxin-61 from Arabidopsis with 80.65% of identity
• Eggnog: syntaxin(ENOG410ZZA3)
• Kegg: Link to kegg annotations (AT1G28490)
• CantataDB: Link to cantataDB annotations (CNT0000374)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435599.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;