Protein coding transcript 2058

• Transcript: Ll_transcript_318507
• CDS coordinates: 3-410 (+)
• Peptide sequence: GFVLTLLAALLYGFILPLVEFSYSKGKQAITYTLVLEIQLVMCFFASLFCLIGMIINKDFQSISREKSHYGLGEATYYVVLVGSVIVWQINFLGAVGVIFCSSSLLCGVVIALMVPITQVLAVIFYKEKFNVEKGV
• ORF Type: internal

Annotations of Ll_transcript_318507

• Blastp: Purine permease 3 from Arabidopsis with 55.15% of identity
• Blastx: Purine permease 3 from Arabidopsis with 55.15% of identity
• Eggnog: purine permease(ENOG410Y9BB)
• Kegg: Link to kegg annotations (AT1G28220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459757.1)
• Pfam: Purine nucleobase transmembrane transport (PF16913.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;