Protein coding transcript 205806

• Transcript: Ll_transcript_268323
• CDS coordinates: 1-870 (+)
• Peptide sequence: EGIIERSFLPGPYSVEISSAVYKNWVFPDQALPADLIKRGLAVEDSSSPHGLRLVIEDYPYAVDGLEIWDAIKTWVRDYVSLYYPTNEAVQKDSELQAWWKDVVEKGHADLKDKPWWPKLQTVDELIQSSSTIIWIGSALHAAVNFGQYPYGGYILNRPTLSRRLIPEKGTPEYDELGTNPQKAYLRTITAKSEALVDLSVIEILSRHASDEIYLGQRDNPNWTSDTRALQAFKKFGTTLAEIEQNITRRNNDPSQRNRTGPVELPYTLLLPTSKEGLTFRGIPNTISI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_268323

• Blastp: Seed linoleate 9S-lipoxygenase from Soja with 76.82% of identity
• Blastx: Seed linoleate 9S-lipoxygenase from Soja with 76.82% of identity
• Eggnog: Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding (By similarity)(ENOG410YN4N)
• Kegg: Link to kegg annotations (547835)
• CantataDB: Link to cantataDB annotations (CNT0000973)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455489.1)
• Pfam: Lipoxygenase (PF00305.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;