Protein coding transcript 205810

• Transcript: Ll_transcript_267292
• CDS coordinates: 286-930 (+)
• Peptide sequence: MKMNWAKEAWRCVSNNKNILRRRFANAPFSDDELSRDFLVKLWVADTKLTNPKNEIRSRRFVKHDDDDDDEARGVLKQPPISQSSLSNPQSVEEAKVSPLLARSNLLITRDIEWANLVFGFEQENRYAIVDVCYPQSPVGFIREQSSIIARQLLRTRRPFVAHITDAVGSELFTVRRPIWWITSSIYAEIDGKEIGVVHRRWHLWRRIYDLYLG*
• ORF Type: complete

Annotations of Ll_transcript_267292

• Blastp: Phospholipid scramblase family protein C343.06c from Schizosaccharomyces with 31.85% of identity
• Blastx: Phospholipid scramblase family protein C343.06c from Schizosaccharomyces with 31.82% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC343.06c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450879.1)
• Pfam: Scramblase (PF03803.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;