Transcript | Ll_transcript_267305 |
---|---|
CDS coordinates | 2223-2732 (+) |
Peptide sequence | MKVLLGSFDDKEKVIVEMPTEDAYRMAMKSMVRWVRLNMDTNKTRVFFTSMSPSHTKSKEWGGKEGGNCYNETTPIDDPTYWGSDSEKSIMQVIEQVFRKSKVPITFLNITQLSSYRKDAHTSIYKKQWNPLSTEQLANPASYADCIHWCLPGLQDTWNELLFAKLFYP* |
ORF Type | complete |
Blastp | Protein trichome birefringence-like 33 from Arabidopsis with 75.6% of identity |
---|---|
Blastx | Protein trichome birefringence-like 33 from Arabidopsis with 76.62% of identity |
Eggnog | leaf senescence related protein(ENOG410ZJIP) |
Kegg | Link to kegg annotations (AT2G40320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416820.1) |
Pfam | GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer