Protein coding transcript 205818

• Transcript: Ll_transcript_267309
• CDS coordinates: 2-616 (+)
• Peptide sequence: LGSMQIMNLSSHSLFRTKLLFSPYLFTTLLAFIFFTAIFYVHHFFIFSQLTPFSTFHNLTQFPSQEKSNVHKVAFAVEETKERCDVFKGRWVKDELARPLYEESECPYIQPQLTCEHHGRPDKDYRHWRWQPHGCDLPKFNASLMLETLRGKRMMFVGDSLNRGQYVSLVCLLHKLIPEDAKSEETFDSLTVFTAKVLGIFCYS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_267309

• Blastp: Protein trichome birefringence-like 33 from Arabidopsis with 65.03% of identity
• Blastx: Protein trichome birefringence-like 33 from Arabidopsis with 66.88% of identity
• Eggnog: leaf senescence related protein(ENOG410ZJIP)
• Kegg: Link to kegg annotations (AT2G40320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416820.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;