Protein coding transcript 205819

• Transcript: Ll_transcript_267312
• CDS coordinates: 158-616 (+)
• Peptide sequence: MPTEDAYRMAMKSMVRWVRLNMDTNKTRVFFTSMSPSHTKSKEWGGKEGGNCYNETTPIDDPTYWGSDSEKSIMQVIEQVFRKSKVPITFLNITQLSSYRKDAHTSIYKKQWNPLSTEQLANPASYADCIHWCLPGLQDTWNELLFAKLFYP*
• ORF Type: complete

Annotations of Ll_transcript_267312

• Blastp: Protein trichome birefringence-like 33 from Arabidopsis with 76.51% of identity
• Blastx: Protein trichome birefringence-like 33 from Arabidopsis with 76.69% of identity
• Eggnog: leaf senescence related protein(ENOG410ZJIP)
• Kegg: Link to kegg annotations (AT2G40320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416820.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;