Transcript | Ll_transcript_267797 |
---|---|
CDS coordinates | 2949-3311 (+) |
Peptide sequence | MQSGCCKPPTACTYKMETLVNQDTDCYKWNNAPTLLCYECDSCKAGVLEEMRRNWHKLSVLTVVMLVFLIGIYSIGCCAFRNTRRAETDYPYGQNRMTKIRPRWDYHWWRWFHDRKEQLY* |
ORF Type | complete |
Blastp | Tetraspanin-5 from Arabidopsis with 56.03% of identity |
---|---|
Blastx | Tetraspanin-5 from Arabidopsis with 56.03% of identity |
Eggnog | Tetraspanin family(ENOG41104VK) |
Kegg | Link to kegg annotations (AT4G23410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441942.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer