| Transcript | Ll_transcript_267797 |
|---|---|
| CDS coordinates | 2949-3311 (+) |
| Peptide sequence | MQSGCCKPPTACTYKMETLVNQDTDCYKWNNAPTLLCYECDSCKAGVLEEMRRNWHKLSVLTVVMLVFLIGIYSIGCCAFRNTRRAETDYPYGQNRMTKIRPRWDYHWWRWFHDRKEQLY* |
| ORF Type | complete |
| Blastp | Tetraspanin-5 from Arabidopsis with 56.03% of identity |
|---|---|
| Blastx | Tetraspanin-5 from Arabidopsis with 56.03% of identity |
| Eggnog | Tetraspanin family(ENOG41104VK) |
| Kegg | Link to kegg annotations (AT4G23410) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441942.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer