Protein coding transcript 205837

• Transcript: Ll_transcript_267778
• CDS coordinates: 168-560 (+)
• Peptide sequence: MIDFSRVQKELVECSKDTEGSGIKVTPKNDNLVRLNGTIPGPTGTPYEGGIFQIDITIPDGYPFEPPKMHFTTKVWHPNISSQSGAICLDILKDQWSPALTLKTALLSVQALLSAPQPDDPQDAVVAQQV*
• ORF Type: complete

Annotations of Ll_transcript_267778

• Blastp: Ubiquitin-conjugating enzyme E2 27 from Arabidopsis with 81.4% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 27 from Arabidopsis with 81.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G50870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441942.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;