Protein coding transcript 205923

• Transcript: Ll_transcript_267177
• CDS coordinates: 3-617 (+)
• Peptide sequence: PPPPPPPETSYPPPPPPPPPSSNAPPPPPVYYSSQYYQPPPPPPPPASPPPASPPPPPKNQNSEVRDRDRGLVKDVSAFGRRENEHSNHGASYKKQKVAAAAAAAVPPMPMKKANGPPPGRVETEEERRLRKKREFEKQRQEEKHRQKLKESQNTVLQKTHMLGKGNGSVIGSRMGERKATPLLSGDRIENRLKKPTTFLCKMK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_267177

• Blastp: Protein PAF1 homolog from Arabidopsis with 39.33% of identity
• Blastx: Protein PAF1 homolog from Arabidopsis with 75% of identity
• Eggnog: paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)(ENOG410YZXE)
• Kegg: Link to kegg annotations (AT1G79730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430327.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;