Transcript | Ll_transcript_267181 |
---|---|
CDS coordinates | 3-617 (+) |
Peptide sequence | PPPPPPPETSYPPPPPPPPPSSNAPPPPPVYYSSQYYQPPPPPPPPASPPPASPPPPPKNQNSEVRDRDRGLVKDVSAFGRRENEHSNHGASYKKQKVAAAAAAAVPPMPMKKANGPPPGRVETEEERRLRKKREFEKQRQEEKHRQKLKESQNTVLQKTHMLGKGNGSVIGSRMGERKATPLLSGDRIENRLKKPTTFLCKMK* |
ORF Type | 5prime_partial |
Blastp | Protein PAF1 homolog from Arabidopsis with 39.33% of identity |
---|---|
Blastx | Protein PAF1 homolog from Arabidopsis with 73.8% of identity |
Eggnog | paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)(ENOG410YZXE) |
Kegg | Link to kegg annotations (AT1G79730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430327.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer