Protein coding transcript 206024

• Transcript: Ll_transcript_267696
• CDS coordinates: 208-1218 (+)
• Peptide sequence: MDDDINNWWYNKDLRYDEWVQIPVSGPRPLPRYKHAAAVVDEKMYIAGGSRNGRQLSDVQVFDLGSFTWSSLKLKANAGEDGDSSSQQILPATSGHSMIRWGEKLLLLGGSSKDSSDHLMVRYIDIETCQFGVIKTSGSVPIARTGQSATLVGSRVILFGGEDMSRKLLNDVHVLDLESMTWDLIKTTQAPPTPRYDHAAAVQGERYLLIFGGCSHSIFFNDLHLLDMQTMEWSQPQIQGDLVSPRAGHAGINVDGSWFIVGGGDNKSGCPETLVWNMSKLVWSVLTVAKQKDPLSSEGLSVCSAMIGGENHLLAFGGYNGRYSNEVCDVTFIFKF*
• ORF Type: complete

Annotations of Ll_transcript_267696

• Blastp: Acyl-CoA-binding domain-containing protein 4 from Arabidopsis with 52.56% of identity
• Blastx: Acyl-CoA-binding domain-containing protein 4 from Arabidopsis with 52.56% of identity
• Eggnog: Kelch domain containing(ENOG410Y5WM)
• Kegg: Link to kegg annotations (AT3G05420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441006.1)
• Pfam: Kelch motif (PF13854.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;