Protein coding transcript 206028

• Transcript: Ll_transcript_267688
• CDS coordinates: 208-1239 (+)
• Peptide sequence: MDDDINNWWYNKDLRYDEWVQIPVSGPRPLPRYKHAAAVVDEKMYIAGGSRNGRQLSDVQVFDLGSFTWSSLKLKANAGEDGDSSSQQILPATSGHSMIRWGEKLLLLGGSSKDSSDHLMVRYIDIETCQFGVIKTSGSVPIARTGQSATLVGSRVILFGGEDMSRKLLNDVHVLDLESMTWDLIKTTQAPPTPRYDHAAAVQGERYLLIFGGCSHSIFFNDLHLLDMQTMEWSQPQIQGDLVSPRAGHAGINVDGSWFIVGGGDNKSGCPETLVWNMSKLVWSVLTVAKQKDPLSSEGLSVCSAMIGGENHLLAFGGYNGRYSNEVFVLRPKARDSLRPKIFQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_267688

• Blastp: Acyl-CoA-binding domain-containing protein 4 from Arabidopsis with 51.06% of identity
• Blastx: Acyl-CoA-binding domain-containing protein 4 from Arabidopsis with 51.06% of identity
• Eggnog: Kelch domain containing(ENOG410Y5WM)
• Kegg: Link to kegg annotations (AT3G05420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441010.1)
• Pfam: Kelch motif (PF13854.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;