Protein coding transcript 206072

• Transcript: Ll_transcript_266569
• CDS coordinates: 2-493 (+)
• Peptide sequence: KHQNLLVDPLTHQVKLCDFGSAKVLVKGETNISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENQVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSAVSRTSLLPNSTSFG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_266569

• Blastp: Shaggy-related protein kinase iota from Arabidopsis with 95.33% of identity
• Blastx: Shaggy-related protein kinase iota from Arabidopsis with 95.33% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G06390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003596713.2)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;