Protein coding transcript 206076

• Transcript: Ll_transcript_266564
• CDS coordinates: 386-853 (+)
• Peptide sequence: MHYMFLNHAMFLNHAMFHDKSPPLLNSVFQVLGTPTREEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCSALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELSGGSPELVNKLIPDHVKRQLGLQFAHQAGS*
• ORF Type: complete

Annotations of Ll_transcript_266564

• Blastp: Shaggy-related protein kinase eta from Arabidopsis with 83.97% of identity
• Blastx: Shaggy-related protein kinase eta from Arabidopsis with 70.79% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G18710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419726.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;