Protein coding transcript 206078

• Transcript: Ll_transcript_266575
• CDS coordinates: 386-769 (+)
• Peptide sequence: MHYMFLNHAMFLNHAMFHDKSPPLLNSVFQVLGTPTREEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCSALEACAHPFFDELREPNARLPNGRPLPPLFNFKQEVSP*
• ORF Type: complete

Annotations of Ll_transcript_266575

• Blastp: Shaggy-related protein kinase zeta from Arabidopsis with 78.81% of identity
• Blastx: Shaggy-related protein kinase eta from Arabidopsis with 70.47% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G30980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419726.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;