Transcript | Ll_transcript_266575 |
---|---|
CDS coordinates | 386-769 (+) |
Peptide sequence | MHYMFLNHAMFLNHAMFHDKSPPLLNSVFQVLGTPTREEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCSALEACAHPFFDELREPNARLPNGRPLPPLFNFKQEVSP* |
ORF Type | complete |
Blastp | Shaggy-related protein kinase zeta from Arabidopsis with 78.81% of identity |
---|---|
Blastx | Shaggy-related protein kinase eta from Arabidopsis with 70.47% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G30980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419726.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer