Protein coding transcript 2061

• Transcript: Ll_transcript_318445
• CDS coordinates: 65-1066 (+)
• Peptide sequence: METLRVQNVASHVNGAIPAMFVRSETEQPGITTVQGSTLQVPIIDFSNPNEEKVLKEIMEASCEWGMFQIVNHDIPSELIRKYQAVGKEFFELSQEEKEKYAKDPNSQSLEGYGTKLQKELDGKKGWVDHLFHKLWPLSDINYRFWPEKPHSYREVTEEYAKYLHGVVDQLFRALSLGLGLEGHELRETVNGDKLVHLLKINYYPPCPHPELVLGVPAHSDMSFLTLLIPNEIQGLQACKDDQWYEVKYVPNAIVVHIGDQMQVISNGKYKPVWHRTTVSKNETRMSWPVFIEPQPEQEVEPHPKLINKDNPPKFKPKKFKDYAYCKLNKIPQ*
• ORF Type: complete

Annotations of Ll_transcript_318445

• Blastp: Flavonol synthase/flavanone 3-hydroxylase from Petunia with 62.8% of identity
• Blastx: Flavonol synthase/flavanone 3-hydroxylase from Malus with 66.87% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414966.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;