Protein coding transcript 206121

• Transcript: Ll_transcript_269405
• CDS coordinates: 2-736 (+)
• Peptide sequence: SDKEPEEQKLERGNLALKNSCEEKNPVRVIRGYGSMDGRPKTLVYDGLYLVESYWQDMGPHGKLVYKFRLRRIPGQPELALKEVKKSKKFKTREGLCVADISHGKERIPVCAVNTVNDEKPPPFKYITSMMYPESNLPRHEGCDCTNGCSDLNKCSCVVENGGEIPFNHNGAIVEAKPLVYECGPSCKCPSTCHNRVSQLGIKFQLEIFKTSTRGWGVRSLNSIPSGSFICEYIGELLEDKEAEQ
• ORF Type: internal

Annotations of Ll_transcript_269405

• Blastp: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 from Arabidopsis with 64.08% of identity
• Blastx: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 from Arabidopsis with 64.08% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT2G35160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421211.1)
• Pfam: SAD/SRA domain (PF02182.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;