Transcript | Ll_transcript_269405 |
---|---|
CDS coordinates | 2-736 (+) |
Peptide sequence | SDKEPEEQKLERGNLALKNSCEEKNPVRVIRGYGSMDGRPKTLVYDGLYLVESYWQDMGPHGKLVYKFRLRRIPGQPELALKEVKKSKKFKTREGLCVADISHGKERIPVCAVNTVNDEKPPPFKYITSMMYPESNLPRHEGCDCTNGCSDLNKCSCVVENGGEIPFNHNGAIVEAKPLVYECGPSCKCPSTCHNRVSQLGIKFQLEIFKTSTRGWGVRSLNSIPSGSFICEYIGELLEDKEAEQ |
ORF Type | internal |
Blastp | Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 from Arabidopsis with 64.08% of identity |
---|---|
Blastx | Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 from Arabidopsis with 64.08% of identity |
Eggnog | Histone-lysine N-methyltransferase(COG2940) |
Kegg | Link to kegg annotations (AT2G35160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421211.1) |
Pfam | SAD/SRA domain (PF02182.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer