Protein coding transcript 206173

• Transcript: Ll_transcript_269164
• CDS coordinates: 300-1031 (+)
• Peptide sequence: MRVSGTEIVFAFLLCGTLSFSAESHRARASTPAVCRRESVFDFILGFSDSTCLTPDSPPSFRYIGVIEGDEVSLQKALNMVHKNSHEYVAVLFFASWCPFSRTLRPDFSIMSSLNPSIPHLAIEESSVRPSILSKYGVHGFPTLFILNSTMRVRYHGSRTLGSLISFYSDVTGVRIDSFDQLSLEKIGRLSVLEKHNNTEPESCPFSWARSPENLLRQETYLALATAFVVLRLLYLCFPTLLIC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_269164

• Blastp: 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 60.09% of identity
• Blastx: 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 60.09% of identity
• Eggnog: thioredoxin domain containing 15(ENOG4111M6Z)
• Kegg: Link to kegg annotations (AT1G34780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417607.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;