Protein coding transcript 206180

• Transcript: Ll_transcript_269166
• CDS coordinates: 1599-2096 (+)
• Peptide sequence: MGFHAIWYLVHCSAVIVGVRIDSLDQPSLQKIGRLLVREKHNHTELESFPFSWARSPENLLRQETYLALATAFVVLRLLYLCFPTLLICIQYVWRRVIQNVTFGSLLEHPSVYLKHLIQSFKCLNEPCKRSNLQEGAMNAKAWASKSLATVSIGEGSTSRGCTSK*
• ORF Type: complete

Annotations of Ll_transcript_269166

• Blastp: 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 54.81% of identity
• Blastx: 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 58.16% of identity
• Eggnog: thioredoxin domain containing 15(ENOG4111M6Z)
• Kegg: Link to kegg annotations (AT1G34780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414444.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;