Protein coding transcript 206187

• Transcript: Ll_transcript_269153
• CDS coordinates: 2287-2784 (+)
• Peptide sequence: MGFHAIWYLVHCSAVIVGVRIDSLDQPSLQKIGRLLVREKHNHTELESFPFSWARSPENLLRQETYLALATAFVVLRLLYLFFPTLLICIQYAWRRVIQNVRLGSLLEHPLVYLKRMIQSFKCLKEPCKRSNLQEGAMNAKAWASKSLATVSIGEGSTSRGCTSK*
• ORF Type: complete

Annotations of Ll_transcript_269153

• Blastp: 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 57.04% of identity
• Blastx: 5'-adenylylsulfate reductase-like 4 from Arabidopsis with 57.04% of identity
• Eggnog: thioredoxin domain containing 15(ENOG4111M6Z)
• Kegg: Link to kegg annotations (AT1G34780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438528.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;