Protein coding transcript 206217

• Transcript: Ll_transcript_268749
• CDS coordinates: 450-992 (+)
• Peptide sequence: MLSGRSGSWTGGNGAWVELSGKMHVLGRLLAHLRQRTNDRIVLVSNYTQTLDLFAQLCRERRYPHLRLDGTTSISKRQKLVNCFNDPYKDEFVFLLSSKAGGCGLNLIGGNRLVLFDPDWNPANDKQAAARVWRDGQKKRVYVYRFLTAGTIEEKVYQRQMSKEGLQKVIQQEQTDSSVAQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_268749

• Blastp: Protein CHROMATIN REMODELING 25 from Arabidopsis with 87.85% of identity
• Blastx: Protein CHROMATIN REMODELING 25 from Arabidopsis with 86.47% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (AT3G19210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444509.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;