Protein coding transcript 206222

• Transcript: Ll_transcript_268763
• CDS coordinates: 478-909 (+)
• Peptide sequence: MHVLGRLLAHLRQRTNDRIVLVSNYTQTLDLFAQLCRERRYPHLRLDGTTSISKRQKLVNCFNDPYKDEFVFLLSSKAGGCGLNLIGGNRLVLFDPDWNPANDKQVICHRLRFINIGNFRTQAFSPLYIIHSFVILFAIYPCS*
• ORF Type: complete

Annotations of Ll_transcript_268763

• Blastp: DNA repair and recombination protein RAD54 from Oryza sativa with 82.14% of identity
• Blastx: Protein CHROMATIN REMODELING 25 from Arabidopsis with 68.58% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (4330819)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444509.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;