Transcript | Ll_transcript_268733 |
---|---|
CDS coordinates | 120-467 (+) |
Peptide sequence | MQTLQAQVKRAITEEVKQSRILGYITALKKLCNHPKLIYDTIRSGNPGTSGFEDCIRFFPPEMLSGRWIVWIIFLRCNFSHTSFKQSFIFLNVEVMLVLLIQHLNQQLVCTQPVS* |
ORF Type | complete |
Blastp | DNA repair and recombination protein RAD54 from Oryza sativa with 70.77% of identity |
---|---|
Blastx | DNA repair and recombination protein RAD54 from Oryza sativa with 71.88% of identity |
Eggnog | helicase(COG0553) |
Kegg | Link to kegg annotations (4330819) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444509.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer