| Transcript | Ll_transcript_268734 |
|---|---|
| CDS coordinates | 152-499 (+) |
| Peptide sequence | MQTLQAQVKRAITEEVKQSRILGYITALKKLCNHPKLIYDTIRSGNPGTSGFEDCIRFFPPEMLSGRWIVWIIFLRCNFSHTSFKQSFIFLNVEVMLVLLIQHLNQQLVCTQPVS* |
| ORF Type | complete |
| Blastp | DNA repair and recombination protein RAD54 from Oryza sativa with 70.77% of identity |
|---|---|
| Blastx | DNA repair and recombination protein RAD54 from Oryza sativa with 71.88% of identity |
| Eggnog | helicase(COG0553) |
| Kegg | Link to kegg annotations (4330819) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444509.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer