Transcript | Ll_transcript_268738 |
---|---|
CDS coordinates | 591-1067 (+) |
Peptide sequence | MHVLGRLLAHLRQRTNDRIVLVSNYTQTLDLFAQLCRERRYPHLRLDGTTSISKRQKLVNCFNDPYKDEFVFLLSSKAGGCGLNLIGGNRLVLFDPDWNPANDKQAAARVWRDGQKKRVYVYRFLTAGTIEEKVYQRQMSKEGLQKVIQQEQTDSSVAQ |
ORF Type | 3prime_partial |
Blastp | Protein CHROMATIN REMODELING 25 from Arabidopsis with 88.05% of identity |
---|---|
Blastx | Protein CHROMATIN REMODELING 25 from Arabidopsis with 77.16% of identity |
Eggnog | helicase(COG0553) |
Kegg | Link to kegg annotations (AT3G19210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444509.1) |
Pfam | Helicase conserved C-terminal domain (PF00271.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer