Protein coding transcript 2063

• Transcript: Ll_transcript_318499
• CDS coordinates: 3-431 (+)
• Peptide sequence: LATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERVTQVAKRKMMLTHLVVRPGMGGKQANFTKQELDDILRFGTEELFKEEEGKEDEAIHYDDKAVEDLLDRSKMGIEQKENWSNEYLSSFKVASYVT
• ORF Type: internal

Annotations of Ll_transcript_318499

• Blastp: Chromodomain-helicase-DNA-binding protein Mi-2 homolog from Sophophora with 88.03% of identity
• Blastx: Chromodomain-helicase-DNA-binding protein Mi-2 homolog from Sophophora with 83.1% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (Dmel_CG8103)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006601181.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;