Transcript | Ll_transcript_268661 |
---|---|
CDS coordinates | 1137-1529 (+) |
Peptide sequence | MCRTLEVLARNQRERNDLGSQPLPMAIYVVSGDEDGERGGAPVVCIEDASRRCSEFSRGLAAWTPLLLLVPLVLGLDKINLRYVPLLQSTFKFPQSLGILGGKPGASTYIIGVQNEKAFYLDPHDVHPVC* |
ORF Type | complete |
Blastp | Cysteine protease ATG4 from Medicago with 87.6% of identity |
---|---|
Blastx | Cysteine protease ATG4 from Medicago with 70.37% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_7g081230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413861.1) |
Pfam | Peptidase family C54 (PF03416.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer